PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000065.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 391aa    MW: 43048.2 Da    PI: 6.5157
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000065.1_g00028.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32240295156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Itr_sc000065.1_g00028.1 240 KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 295
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-29237298IPR009057Homeodomain-like
PROSITE profilePS5129414.875237297IPR017930Myb domain
SuperFamilySSF466899.71E-19238298IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-28240295IPR006447Myb domain, plants
PfamPF002497.8E-8242293IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MLISIHDPAA STNYPEKMRR CQEYIEALEE ERRKIQVFQR ELPLCLELVT QAIEAYKQEL  60
CGTRSGCNLN GQSECSEQIT SSDDEGPVLE EFIPLKRASS LSQEEEDDEQ QSPNKSTNHR  120
TDDDDDNINN NVDSSDYSSK DGKNSTDDKV SKKQDWLRSA QLWNQSFTDP TPKEESPSNC  180
KAAVMGVKRN GSGGAFHPFK REKSSAAVQT LVSTPAKTAD EGNGGGGSKK EEKETQSQRK  240
QRRCWSPELH RRFLQALQQL GGSHVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTRRPT  300
PSIRNNGSQQ GPQFVVVGGI WVPPPEYAAA MAAPATSGEA ATSNGIYAPI ATTPKQAQQN  360
GINHSEGGGA RRSDSPSTSY STHTTTTSHS S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.11e-141PREDICTED: uncharacterized protein LOC105156412
TrEMBLB9HIZ71e-130B9HIZ7_POPTR; Uncharacterized protein
STRINGPOPTR_0008s11630.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-92G2-like family protein